SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010101 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000010101
Domain Number - Region: 137-249
Classification Level Classification E-value
Superfamily Caspase-like 0.0384
Family Caspase catalytic domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010101   Gene: ENSRNOG00000007089   Transcript: ENSRNOT00000010101
Sequence length 435
Comment pep:known chromosome:Rnor_5.0:6:135492944:135518919:-1 gene:ENSRNOG00000007089 transcript:ENSRNOT00000010101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWKVAVLLSLVLGAGAVHIGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHR
NGIPDEQIIVMMYDDIANNEENPTPGVVINRPNGTDVYKGVPKDYTGEDVTPENFLAVLR
GDEEAVKGKGSGKVLKSGPRDHVFVYFTDHGATGILVFPNEDLHVKDLNKTIRYMYEHKM
YQKMVFYIEACESGSMMNHLPDDIDVYATTAANPNESSYACYYDEERSTYLGDWYSVNWM
EDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPP
VTHLDLTPSPDVPLTILKRKLLRTNNMKESQVLVGQIQHLLDARHIIEKSVQKIVSLLAG
FGETAQKHLSERAMLTAHDCHQEAVTHFRTHCFNWHSVMYEHALRYLYVLANLCEKPYPI
DRIKMAMDKVCLSHY
Download sequence
Identical sequences Q5PPG2
ENSRNOP00000010101 ENSRNOP00000010101 10116.ENSRNOP00000010101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]