SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010244 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010244
Domain Number 1 Region: 156-419
Classification Level Classification E-value
Superfamily Caspase-like 2.84e-78
Family Caspase catalytic domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 15-85
Classification Level Classification E-value
Superfamily DEATH domain 0.00000341
Family Caspase recruitment domain, CARD 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010244   Gene: ENSRNOG00000033434   Transcript: ENSRNOT00000010243
Sequence length 420
Comment pep:known chromosome:Rnor_5.0:8:2682098:2708341:1 gene:ENSRNOG00000033434 transcript:ENSRNOT00000010243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTAKRTHERDPIYKIKGLAKDMLDGVFDDLMDKNVLNGDELLKIGEGASLILSKAENLVE
SFFEKTEMAGKIFAGHIANSDKQLSLQFXSDDEXXELLXMFTXXSASESRGKVEDEEMEV
NVGVAHASHLMLTVPQGIQSTEVQDSLKLCSRDWFCTMKTERAEEIYPVMEKEGRTRLAL
IICNKKFDYLFDRDDAETDILNMKELLQNLGYSVVIKENLTAQEMETELMKFAGRPEHQS
SDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFTIFNNSNCPSLRNKPKILIMQACR
GRHTGTIWVSTSKGIATADTDEECVLSHRWNNSITKAHVETDFIAFKSSTPHNISWKVGK
SGSLFISKLIDCFKKYCWCYHLEEIFRKVQYSFEVPGELTQMPTIERVSMTRYFYLFPGN
Download sequence
Identical sequences ENSRNOP00000010244 ENSRNOP00000010244 10116.ENSRNOP00000010244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]