SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010798 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010798
Domain Number 1 Region: 98-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-18
Family Complement control module/SCR domain 0.00022
Further Details:      
 
Domain Number 2 Region: 159-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0000387
Further Details:      
 
Domain Number 3 Region: 349-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000109
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 4 Region: 298-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 5 Region: 231-291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000472
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 6 Region: 37-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000708
Family Complement control module/SCR domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010798   Gene: ENSRNOG00000008193   Transcript: ENSRNOT00000010799
Sequence length 498
Comment pep:known chromosome:Rnor_5.0:13:118373053:118420106:-1 gene:ENSRNOG00000008193 transcript:ENSRNOT00000010799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASSPLDPVGRLVAFCRGGVHLAVLLLFLSPSTLGQCPAPPLFPYAKPINPTDESTFPV
GTSLKYECRPGYIKRQFSITCEVNSVWTSPQDVCIRKQCETPLDPQNGIVHVNTDIRFGS
SITYTCNEGYRLIGSSSAMCIISDQSVAWDAEAPICESIPCEIPPSIPNGDFFSPNREDF
HYGMVVTYQCNTDARGKKLFNLVGEPSIHCTSIDGQVGVWSGPPPQCIELNKCTPPHVEN
AVIVSKNKSLFSLRDMVEFRCQDGFMMKGDSSVYCRSLNRWEPQLPSCFKVKSCGAFLGE
LPNGHVFVPQNLQLGAKVTFVCNTGYQLKGNSSSHCVLDGVESIWNSSVPVCEQVICKLP
QDMSGFQKGLQMKKDYYYGDNVALECEDGYTLEGSSQSQCQSDASWDPPLPKCVSRKSNA
LHLGIFIGIIVLILFIIFSYWMIMKFKKRNSTNEKCKEVGIYLNSKEDSCVQPQSLLTSQ
ENNRSTSSPARNSLTQEV
Download sequence
Identical sequences ENSRNOP00000010798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]