SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000010910 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000010910
Domain Number 1 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 2 Region: 526-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 3 Region: 717-776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.00052
Further Details:      
 
Domain Number 4 Region: 847-912
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 5 Region: 275-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000012
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 6 Region: 411-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 7 Region: 355-416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000109
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 8 Region: 215-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 9 Region: 603-666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000124
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 10 Region: 901-965
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 11 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 12 Region: 89-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 13 Region: 782-841
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000792
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 14 Region: 680-728
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000334
Family Complement control module/SCR domain 0.0062
Further Details:      
 
Domain Number 15 Region: 483-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000181
Family Complement control module/SCR domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000010910   Gene: ENSRNOG00000034164   Transcript: ENSRNOT00000010910
Sequence length 1029
Comment pep:known chromosome:Rnor_5.0:13:118587318:118617951:-1 gene:ENSRNOG00000034164 transcript:ENSRNOT00000010910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALGSLWVFFALIAPGVLELSCDPPPEVNNTRRLYYSLPVLPGTVVRYTCLPGYRLIGE
KAIFCISKDQVTATWDKATPICEPWNKMSACSKPIVPGGIINPGSRPPFKHGDSVTVTCK
ANFTMKGSKTVWCRANKMWGPTPLPVCESDFPLECPSLPTIHNGHHTGQHVEKFVAGLSV
TYSCEPGYLLVGKKTIKCLSSGAWDDVIPTCKEAKCERPEKLPNGQVKEPPSLRVGTTVY
FSCNEGYELQGQPSSKCVIVEQKAVWTKKPVCKEILCPPPPPVLNGRHSGRFSGNVPYGN
NVTYMCDPSPEKGVNFTLIGEKTIYCTNSSEKTGIWSGPAPYCKLSISEAQCLRPQINRG
QILSILKESYSYNDTVAFSCEPGFTLKGSGRIRCSAQGTWKPPVPVCEKGCQAPPKIING
QKEDRYFLNFDPGTSIRYSCDPGYFLVGEDTIHCTSEGKWTPIPPQCKVAECKPVGPHVF
ERPQNHFIRPAINSSCDEGFQISESAYQLCQGTIPWFIEIRLCKEITCPPPPIILNGTHT
WRSSEDVPYGTVITYMCYPGSEEGVKFKLIGEQTIHCTSDSRGRGSWSSPAPLCKLSLPA
VQCTEVHVENGVKLTDNKAPYFYNNSVTFKCRDGYILIGSSQIRCKANNTWDPEAPHCKK
EGCEPMRKLPGISDHSLIKLVNRTCQNGYQLTGYTYEKCQNAENGTWFQKIAVCTVILCP
PPPTIANGSHTGMMAEHFLYGNEVSYECDKGFYLLGEKSLQCKGHGSWSGPPPQCLQSSP
LTHCPDPEVKYGYKLNKTHSAYSHNDIIHVVCNQGFIMNGSHLIRCHTNNTWLPGVPTCI
RTASLGCQSPPTIPNGNHTGGTIARFSPGMSVMYSCYQGYLMAGEARLICTHEGTWSHPA
PYCKEVNCSFPEDTNGIQKGFQPGKTYRFGTTVTLECEDGYSLEGSPQSQCQDENQWNPP
LAICKNRSTVPLVSGISAGSAFIILISVIFFIILKSRERNYYTKTRPKDGALHLETREVY
AVDPYNPAS
Download sequence
Identical sequences D3Z9F7
ENSRNOP00000010910 NP_001099459.2.100692 NP_001099459.2.4139 XP_006250539.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]