SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011084 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011084
Domain Number 1 Region: 157-347
Classification Level Classification E-value
Superfamily PH domain-like 8.15e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000452
Further Details:      
 
Domain Number 2 Region: 507-609
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-24
Family SH2 domain 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011084   Gene: ENSRNOG00000037134   Transcript: ENSRNOT00000011084
Sequence length 622
Comment pep:known chromosome:Rnor_5.0:3:124421964:124514515:-1 gene:ENSRNOG00000037134 transcript:ENSRNOT00000011084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERSQDSQAGLTLYVGLFGHLGMLHRTKYSRFRNESITSLDEGSPGGSVGNKGSSPPPY
AALTPHLPAEDATVPNQESPTALCTLIPRMASMKLANPVTFLSLKTFCLGSKQVPRLKLQ
ENQDQTPSSPASPETSLNSTGPAPTPLPDQVGCRPTSLRPDTCPLPGPGEPNPRSKQDGP
PLQHLLGNGLNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGVHGAIKKRK
APVKFLTTVLGKSNLQFSGMNIKLTVSTSSLTLMNLDNQQIIANHQMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGTAQDIISTIGQAFELRFKQYLKNPSLNTWEREEVL
VDGTSEDRGHDYYNSIPGKQPPAGGIADVRIQVQADPVAYCPIRCEKLCYLPGTSTCSGV
YKNCMGRSRPIGIPHERAMQSDAASLRHFWRVDLFDDPCYVNTQNMRGCAGNQSSTLPQG
SPWHLGKAPETVQPGATAKPGSSHALPHIKQQLWSEECFHGRLSRGAAERLLVKDGDFLV
RESVTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDNSLPIISSG
SEVSLKQPVKKHNNPGLSHSKK
Download sequence
Identical sequences D4A3K2
NP_001177994.1.100692 NP_001177994.1.4139 10116.ENSRNOP00000011084 ENSRNOP00000011084 ENSRNOP00000011084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]