SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011385 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000011385
Domain Number - Region: 25-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00511
Family G proteins 0.01
Further Details:      
 
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily Globin-like 0.098
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011385   Gene: ENSRNOG00000008424   Transcript: ENSRNOT00000011385
Sequence length 315
Comment pep:known chromosome:Rnor_5.0:8:68247490:68284415:1 gene:ENSRNOG00000008424 transcript:ENSRNOT00000011385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSATFTGDRLVQHILGTEDAVVEATSSDAVRFYPWTIDNKYYSAEVNL
CVVPSKCRVTAEIAEAVQAFVVYFDSTQKSGLDSVSSWLPLAETWLPEVMILVCDRVCED
GINRQQAQEWCIKHGFELVELCPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
SQGFSLLNSLAGASRSVGSAESCQCEQEPSPTAERTESLPGHRSGACGPAGAQVDSIVDP
MLDLDIQELASLTTGGGDLENFERLFSKLKEMKDKAATLPHEQRKLHAEKVAKAFWMAIG
GDRDEIEGLSSDDEH
Download sequence
Identical sequences Q9R0Z7
NP_599225.1.100692 NP_599225.1.4139 ENSRNOP00000011385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]