SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011941 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011941
Domain Number 1 Region: 28-285
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-126
Family MioX-like 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011941   Gene: ENSRNOG00000008694   Transcript: ENSRNOT00000011941
Sequence length 285
Comment pep:known chromosome:Rnor_5.0:7:129994007:129996495:1 gene:ENSRNOG00000008694 transcript:ENSRNOT00000011941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKR
IQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDL
DMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW
Download sequence
Identical sequences Q9QXN4
GO.59641 10116.ENSRNOP00000011941 ENSRNOP00000011941 ENSRNOP00000011941 NP_665714.2.100692 NP_665714.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]