SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000011994 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000011994
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.5e-58
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.01e-32
Family Tetramerization domain of potassium channels 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000011994   Gene: ENSRNOG00000039544   Transcript: ENSRNOT00000011994
Sequence length 650
Comment pep:known chromosome:Rnor_5.0:X:16288759:16301947:-1 gene:ENSRNOG00000039544 transcript:ENSRNOT00000011994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARWPTKEQPCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEGQMLCVRSRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPMGPGSLFSSCCSRRGERR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCESRDFVAAIIS
IPTPPANTPDESQPSSPGGGGSGGMANTTLRNSSLATPCLLPETVKISSL
Download sequence
Identical sequences D3ZYK3
NP_001099218.1.100692 NP_001099218.1.4139 ENSRNOP00000011994 ENSRNOP00000011994 10116.ENSRNOP00000011994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]