SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012427 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012427
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-38
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-34
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 3 Region: 261-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-33
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012427   Gene: ENSRNOG00000009221   Transcript: ENSRNOT00000012427
Sequence length 376
Comment pep:novel chromosome:Rnor_5.0:5:130549339:130559519:1 gene:ENSRNOG00000009221 transcript:ENSRNOT00000012427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAEMEACLLLAAVLLDSGPGTHAMEGVKCGGVLSAPSGNFSSPNFPSLYPYNTECSWLI
VVAEGSSVLLTFHTFDLEYHDTCGFDFLEIYNGASRDKGNLLGRFCGQAPPPPFTSSWHV
MSVVFHSDKHVASRGFSAGYQKDVCGGVLTGLSGILSSPEYPNNYPNNVECHWLIRASGP
ATVKLVFVDFQVEGSEECMYDHVTVLGAPGPAHGHHYCGSTRPPTLVSLGHELQVVFKSD
FNIGGRGFKAHYFSGECQEVFTAVRGNFSSPQYPGAYPNNIRCHWTIRLPPGYRVKVFVL
DLGLEEPNSLTRTCDFDHLAAFDGASEEAKLLGKWCGHHLPPPVTSSHNQLLLLLHTDRS
TSGRGFSVAYIGGQLG
Download sequence
Identical sequences D3ZG42
10116.ENSRNOP00000012427 ENSRNOP00000012427 ENSRNOP00000012427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]