SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012645 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012645
Domain Number 1 Region: 154-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 36-150
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-32
Family Pleckstrin-homology domain (PH domain) 0.0000105
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000012645
Domain Number - Region: 548-644
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012645   Gene: ENSRNOG00000009347   Transcript: ENSRNOT00000012645
Sequence length 648
Comment pep:known chromosome:Rnor_5.0:4:183812925:183891522:-1 gene:ENSRNOG00000009347 transcript:ENSRNOT00000012645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKVETVKIARSRSVMTGEQMAAFHPPTTPNPLERPIKMGWLKKQRSIV
KNWQQRYFVLKARQLYYYKDEEDSKPQGCMYLPGSTVKEIATNPEEAGKFVFEVIPASSD
QNRTGQDSYVLMASSQVEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPIL
VEKCSEFILEHGVSEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYL
RDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELEKQLSILPRDNYNLLSYICRFLHEIQ
LNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDA
PLSPPAQKNDAKKAPVPRSSVGWDATEDPPLSRTDSFNNTASSPDATSPTGPQPGDQHQE
DSGKAPKENPGDWKMQSRKRTQTLPNRKCFLTSAFQGTTSSKLEIFKNEFWSPSSEAKAG
EGHRRTMSQDLRHLSNDQRTSTYDNVPNPPVSQGNPAGELSPPASDSKRDAPVSTDSEME
SGSKNSGEEDPDSLQRTVQHLQKEIEAQKQMYEEQIKNLEKENYDVWAKVVRLNEELERE
RKKFAALEISLRNVERSREDVEKRNRVLEEEVKEFVKSMEKSKTKTDA
Download sequence
Identical sequences D3ZGL1
10116.ENSRNOP00000012645 NP_001102717.1.100692 NP_001102717.1.4139 ENSRNOP00000012645 ENSRNOP00000012645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]