SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013543 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013543
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-27
Family Kringle modules 0.00078
Further Details:      
 
Domain Number 2 Region: 195-301
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013543   Gene: ENSRNOG00000009947   Transcript: ENSRNOT00000013543
Sequence length 454
Comment pep:known chromosome:Rnor_5.0:14:86114543:86175895:-1 gene:ENSRNOG00000009947 transcript:ENSRNOT00000013543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPAPGPRPSPECFTANGADYRGTQSWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLG
EHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTS
NKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKHGEAASTECNSVCFGDHTQPCG
GDGRIILFDTLVGACGGNYSSMAAVVYSPDFPDTYATGRVCYWTIRVPGASRIHFNFTIF
DIRDSADMVELLDGYTHRVLVRFDGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQ
ATKEEPPQERPAINQTLAEVITEQANLSVSAAHSSKVLYVITSSPSHPPQTVPGSHSWVP
SVGASGHRVEGWTVYGLATLLILTVTAVVAKILLHVTFKSHRVTASGDLRDCRQPGTSGE
IWTIFYEPSTTISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences ENSRNOP00000013543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]