SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013851 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013851
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.34e-46
Family G proteins 0.000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013851   Gene: ENSRNOG00000010224   Transcript: ENSRNOT00000013851
Sequence length 175
Comment pep:known chromosome:Rnor_5.0:1:163889802:163905429:1 gene:ENSRNOG00000010224 transcript:ENSRNOT00000013851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQLQIWDTAGQERFRSITQSYYRSANALILT
YDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYY
LETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN
Download sequence
Identical sequences A0A1D5RFN1 A0A287D811 A0A2I2YCH3 A0A2I3GKS3 A0A2I3MD23 A0A2I3SCN0 A0A2K5DQ97 A0A2K5NCB5 A0A2K5QQ63 A0A2K5V6E4 A0A2K5ZS75 A0A2K6CWJ2 A0A2K6FC98 A0A2K6M4S2 A0A2K6PBY9 A0A2K6TJ60 D3YV16 H0V4J6 Q5BK72
NP_001015012.1.100692 NP_001015012.1.4139 XP_009005598.1.60252 XP_010361174.1.97406 XP_010851517.1.44457 XP_010971742.1.22495 XP_016777214.1.37143 XP_016777215.1.37143 XP_017400419.1.71028 XP_017400420.1.71028 XP_017730706.1.44346 XP_017833238.1.60252 ENSMUSP00000102797 ENSRNOP00000013851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]