SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013884 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013884
Domain Number 1 Region: 135-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000266
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 2 Region: 92-134
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000274
Family Retrovirus zinc finger-like domains 0.00097
Further Details:      
 
Domain Number 3 Region: 52-91
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000137
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 4 Region: 2-27
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000353
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013884   Gene: ENSRNOG00000010239   Transcript: ENSRNOT00000013884
Sequence length 177
Comment pep:known chromosome:Rnor_5.0:4:184999246:185008099:-1 gene:ENSRNOG00000010239 transcript:ENSRNOT00000013884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCY
SCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Download sequence
Identical sequences A0A096MUF2 A0A0D9R8Y5 A0A0S2Z4K2 A0A1A6HRT0 A0A1S3A9Y9 A0A1S3GHT5 A0A1U7QFI7 A0A1U7U3J8 A0A250YBA3 A0A286XE82 A0A287B975 A0A2I3GIA1 A0A2J8TVF8 A0A2K5KBW3 A0A2K5L0G2 A0A2K5RV72 A0A2K6A618 A0A2K6B8S2 A0A2K6KNC3 A0A2K6RVQ6 A0A2K6T2Y2 D2H7C8 G1TUC2 G3HID6 G3SQK8 G5AMJ3 H2QNB9 I2CYV1 I3LW35 L8HVI2 L8Y1Q8 M3Z0U3 P62633 P62634 Q3ULK8 Q4R501 Q5R5R5
HGL_H00000303844 ENSNLEP00000017627 ENSETEP00000006833 ENSDORP00000002739 ENSTTRP00000014470 ENSLAFP00000002091 ENSCPOP00000011536 gi|4827071|ref|NP_003409.1| ENSSARP00000010717 ENSETEP00000006833 ENSMPUP00000017205 ENSOCUP00000020647 ENSFCAP00000024933 ENSPCAP00000010766 ENSPCAP00000010766 GO.59158 10141.ENSCPOP00000011536 9544.ENSMMUP00000015215 9598.ENSPTRP00000026477 9600.ENSPPYP00000015014 9615.ENSCAFP00000006421 9685.ENSFCAP00000008031 9986.ENSOCUP00000020647 ENSOPRP00000005024 ENSOPRP00000005024 ENSMUSP00000109249 ENSMPUP00000017205 ENSPPYP00000015013 ENSPANP00000003453 ENSDORP00000002739 ENSTTRP00000014470 ENSRNOP00000013884 ENSOCUP00000020647 ENSSARP00000010717 ENSP00000410619 ENSLAFP00000002091 ENSMMUP00000015215 ENSCPOP00000011536 ENSP00000410619 ENSPPYP00000015013 ENSMMUP00000015215 ENSFCAP00000008031 ENSDNOP00000019523 NP_001126703.1.23681 NP_001239193.1.84170 NP_001270242.1.63531 NP_003409.1.87134 NP_003409.1.92137 NP_072120.1.100692 NP_072120.1.4139 XP_002758716.2.60252 XP_002917687.1.58354 XP_003279960.1.23891 XP_003363101.1.31192 XP_003462806.1.53824 XP_003503607.1.69978 XP_003829462.1.60992 XP_003982588.1.62641 XP_004036322.1.27298 XP_004091798.1.23891 XP_004091799.1.23891 XP_004284381.1.21590 XP_004313090.1.83887 XP_004368439.1.4749 XP_004395748.1.74151 XP_004442981.1.5094 XP_004475998.1.11602 XP_004613180.1.94378 XP_004645654.1.9945 XP_004692391.1.23501 XP_004702415.1.18182 XP_004738681.1.14098 XP_005071189.1.91757 XP_005340499.2.77405 XP_005364885.1.66349 XP_005387053.1.28644 XP_005871514.1.60319 XP_005908169.1.15283 XP_006078916.1.26621 XP_006091379.1.53796 XP_006505542.1.92730 XP_006742456.1.47382 XP_006772558.1.95426 XP_006870539.1.41390 XP_006901416.1.29581 XP_006909106.1.64745 XP_007092968.1.5354 XP_007130896.1.24612 XP_007465343.1.90284 XP_007531687.1.11023 XP_007622761.1.28591 XP_007948822.1.48129 XP_007983592.1.81039 XP_008064670.1.4292 XP_008157444.1.99482 XP_008258558.1.1745 XP_008539431.1.77740 XP_008563448.1.73410 XP_008696042.1.72690 XP_008826765.1.79516 XP_009444666.1.37143 XP_010335201.1.74449 XP_010353038.1.97406 XP_010836258.1.44457 XP_011384187.1.92234 XP_011732857.1.29376 XP_011806089.1.43180 XP_011806090.1.43180 XP_011806091.1.43180 XP_011857594.1.47321 XP_011857595.1.47321 XP_011857596.1.47321 XP_011915731.1.92194 XP_012290425.1.9421 XP_012887784.1.60039 XP_014440211.1.99106 XP_014708611.1.49734 XP_014930736.1.86478 XP_014985631.1.72884 XP_015362251.1.40921 XP_015973912.1.101085 XP_016052832.1.3490 XP_017367425.1.71028 XP_017515357.1.32401 XP_017740483.1.44346 XP_019286493.1.44245 XP_019840105.1.53367 XP_020035128.1.5219 XP_020138829.1.48125 XP_020925079.1.46622 XP_020925080.1.46622 XP_021045028.1.100879 XP_021494472.1.76796 XP_021550563.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]