SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013994 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013994
Domain Number 1 Region: 61-180,256-362
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.23e-62
Family FabD-like 0.0001
Further Details:      
 
Domain Number 2 Region: 207-263
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000288
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000013994   Gene: ENSRNOG00000010539   Transcript: ENSRNOT00000013994
Sequence length 380
Comment pep:known chromosome:Rnor_5.0:7:124401456:124412526:-1 gene:ENSRNOG00000010539 transcript:ENSRNOT00000013994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNARVARACWAWGSWGRRPASSLREPPPDAVDVAGLLRDSSVTEEGVQEAVARRPPSRCS
VLLFPGQGSQAVGMGGGLLHFPRVRQLYEAAHRVLGYDLLELCLRGPQEDLDRTVHCQPA
VFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKVRAEAMQ
EASEAVPSGMLSVLGQRQSNFSFACLEAQEHCRSLGIENPVCQVSNYLFPDCRVISGHLE
ALQFLRKNSAKFHFRRTKMLPVSGGFHTCLMEPAVEPLMKTLGSINIKKPLVAVHSNVSG
HKYTHPQHIRKLLGQQVVSPVKWEQTMHCIYERKKGMEFPSTFEVGPGQQLGSILKCCNR
QAWKSYSHVDVMQTLLDPDH
Download sequence
Identical sequences D3ZPF2
ENSRNOP00000013994 NP_001178717.1.100692 NP_001178717.1.4139 XP_006242153.1.100692 ENSRNOP00000013994 10116.ENSRNOP00000013994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]