SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014015 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014015
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-46
Family Sec7 domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 61-139
Classification Level Classification E-value
Superfamily F-box domain 5.23e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014015   Gene: ENSRNOG00000010502   Transcript: ENSRNOT00000014015
Sequence length 319
Comment pep:known chromosome:Rnor_5.0:16:36936326:36981671:-1 gene:ENSRNOG00000010502 transcript:ENSRNOT00000014015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVARNQHLQQEAYGETGYLSREQSRRVASSNISHTSHRKQAQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPEEGVSYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences Q5M7U1
NP_001012050.1.100692 NP_001012050.1.4139 ENSRNOP00000014015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]