SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014022 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014022
Domain Number 1 Region: 1-484
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-164
Family Motor proteins 0.0000000434
Further Details:      
 
Domain Number 2 Region: 901-998
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-28
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1081-1200
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1484-1553,1596-1640
Classification Level Classification E-value
Superfamily Second domain of FERM 2.91e-18
Family Second domain of FERM 0.008
Further Details:      
 
Domain Number 5 Region: 1019-1073
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000192
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 864-902
Classification Level Classification E-value
Superfamily PH domain-like 0.000000151
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000014022
Domain Number - Region: 507-616,904-929
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000858
Family BAR domain 0.075
Further Details:      
 
Domain Number - Region: 1391-1477
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00482
Family Ras-binding domain, RBD 0.034
Further Details:      
 
Domain Number - Region: 1644-1730
Classification Level Classification E-value
Superfamily PH domain-like 0.0283
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014022   Gene: ENSRNOG00000010161   Transcript: ENSRNOT00000014022
Sequence length 1748
Comment pep:known chromosome:Rnor_5.0:2:97712779:97789261:1 gene:ENSRNOG00000010161 transcript:ENSRNOT00000014022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQISFKTALGRSAELLGLDPTQLTDA
LTQRSMFLRGEEILTPLSVQQAVDSRDSLAMALYARCFEWVIKKINSRIKGKDDFKSIGI
LDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGEC
LDLIEKKLGLLALINEESHFPQATDSTLLEKLHNQHANNHFYVKPRVAVNNFGVKHYAGE
VQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHISSRNNQDTLKCGSKHRRPTVS
SQFKDSLHSLMATLSSSNPFFVRCIKPNTQKMPDQFDQAVVLNQLRYSGMLETVRIRKAG
YAVRRPFQDFYKRYKVLMRDLALPEDIRGKCTVLLQFYDASNSEWQLGKTKVFLRESLEQ
KLEKRREEEIDRAAMVIRAHILGYLARKQYRKVLCGVVTIQKNYRAFLARKRFLHLKKAA
IVFQKQLRGRLARKVYRQLLAEKRELEERKRLEEEKKREEEERERKRAQREADLLRAQQE
AETRKQQELEALQKNQREADLTRELEKQRENKQVEEILRLEKEIEDLQRMKEQQELSLTE
ASLQKLQQLRDEELRRLEDEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEISGELSE
LAENASGEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSS
EEDPYMNYTVVPTSPSADSTVLLAASVQDSASLHNSSSGESTYCMPQNNGDLPSPDGDYD
YDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRYSVGTYNSSGAYRFSSEGAQSSFEDSEE
DFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFRSK
QEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGTVEVRSAKEII
DNTNKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHSSTDQEIREMHDEQANPQNAV
GTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQRSKGDTRVEG
QEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSV
VPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKAPIDTPTQQLI
QDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAI
KIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQ
ILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFIYESLKKTKCREFVPSRDE
IEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGQ
VDKAIESRTIVADVLAKFEKLAATSEAGDAPWKFYFKLYCFLDTDSMPKDSVEFAFMFEQ
AHEAVIHGHHPAPEESLQVLAALRLQYLQGDYTLHTSVPPLEEVYSLQRLKARISQSTKT
FTPYERLEKRRTSFLEGTLRRSFRTGTVARQKVEEEQMLDMWIKEEICSARASIIDKWKK
LQGVSQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGKP
LEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRS
LSSQGSSR
Download sequence
Identical sequences F1M9V6
NP_001101127.1.100692 NP_001101127.1.4139 ENSRNOP00000014022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]