SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014139 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014139
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-29
Family Pleckstrin-homology domain (PH domain) 0.0000057
Further Details:      
 
Domain Number 2 Region: 32-131
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-25
Family SH2 domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014139   Gene: ENSRNOG00000010575   Transcript: ENSRNOT00000014139
Sequence length 279
Comment pep:known chromosome:Rnor_5.0:2:261723411:261772455:-1 gene:ENSRNOG00000010575 transcript:ENSRNOT00000014139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLGGNMSTQDPSELWGRADGGSDLFQDLGWYHSNLTRHAAEALLLSNGRDGSYLL
RDSNEQTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEYSSLKDFVKHFANQPLIGSETG
TLIVLKHPYPRQVEEPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLQRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQDRVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSKIRKQLDQDDTIRSRSFIFK
Download sequence
Identical sequences D4ACC1
10116.ENSRNOP00000014139 ENSRNOP00000014139 NP_001102038.1.100692 NP_001102038.1.4139 ENSRNOP00000014139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]