SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014492 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014492
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000806
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000952
Further Details:      
 
Domain Number 3 Region: 645-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-37
Family MAM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-33
Family Spermadhesin, CUB domain 0.00000126
Further Details:      
 
Domain Number 5 Region: 26-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014492   Gene: ENSRNOG00000010744   Transcript: ENSRNOT00000014492
Sequence length 922
Comment pep:known chromosome:Rnor_5.0:19:71984687:72136034:1 gene:ENSRNOG00000010744 transcript:ENSRNOT00000014492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGLPLLCATLALALALAGAFRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQA
PEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAP
KMSEIILEFESFDLEQDSNPPGGVFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQITASSQYGTN
WSVERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRV
DISSNGEDWITLKEGNKAIIFQGNTNPTDVVFGVFPKPLITRFVRIKPASWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRTGWALPPSPHPY
INEWLQVDLGDEKIVRGVIIQGGKHRENKVFMRKFKIAYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRAFTPLSTRFIRIYPERATHSGLGLRMELLGCEVEVPTAGPTTPNGNPV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDSHAQLRWRVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQSSAH
CMTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMVVGHQGDHWKEGRVLLHKSLKLYQVI
FEGEIGKGNLGGIAVDDISINNHIPQEDCAKPTDLDKKNTEIKIDETGSTPGYEEGKGDK
NISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNF
ELVDGVKLKKDKLNPQSNYSEA
Download sequence
Identical sequences Q9QWJ9
ENSRNOP00000014492 10116.ENSRNOP00000014492 NP_659566.1.100692 NP_659566.1.4139 XP_006255887.1.100692 ENSRNOP00000014492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]