SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015081 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015081
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-22
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 6.57e-20
Family Platelet-derived growth factor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015081   Gene: ENSRNOG00000010695   Transcript: ENSRNOT00000015081
Sequence length 345
Comment pep:known chromosome:Rnor_5.0:2:199362291:199537365:1 gene:ENSRNOG00000010695 transcript:ENSRNOT00000015081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNTVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLCKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSA
LSLDLLNNAVTAFSTVEELIRFLEPDRWQIDLDSLYKPTWPLLGKAFLYGKKSKAVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKIGVKGLHKSLTDVALEHHEECDCVCRGNTEG
Download sequence
Identical sequences Q9EQX6
10116.ENSRNOP00000015081 ENSRNOP00000015081 ENSRNOP00000015081 NP_112607.1.100692 NP_112607.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]