SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015468 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015468
Domain Number 1 Region: 190-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-17
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 397-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 3 Region: 140-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 35-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000275
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015468
Domain Number - Region: 328-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 355-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00471
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015468   Gene: ENSRNOG00000011592   Transcript: ENSRNOT00000015468
Sequence length 711
Comment pep:known chromosome:Rnor_5.0:15:36993827:36999985:1 gene:ENSRNOG00000011592 transcript:ENSRNOT00000015468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSALPFLLLLLGGALARPDRIPFLNSACEAPPAVLLEVQGTLQRPLGRDSRSSPANCTW
VILGSKEQTVTVRFQKLHLACGSEHLILHSPLQPPVSLCEAPAGPLQLPGGNVTITYSYA
GARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCRSDPF
PNPVPAPTPPCNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDL
SYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNAT
YHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHY
PCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQ
PDCTDGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLS
RMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGGT
SGGRRRQRGRSVRRLVRRLRRWGLLPRTNTPARAPETRSQATPSVPSEALDDSTGQACEG
GAVGGQDGEQAPPLPIKSPIPTPSTLPALATASEPPGPLPSVPVESSLLSGVVQVLRGRL
LPSLWPPGPTWTPTGTHTAVLPLEDEDDVLLMPLAEPEVWVVEAEDEPLLA
Download sequence
Identical sequences Q496Z8
ENSRNOP00000015468 NP_001032866.1.100692 NP_001032866.1.4139 ENSRNOP00000015468 10116.ENSRNOP00000015468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]