SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015733 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015733
Domain Number 1 Region: 528-560,635-708
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000675
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015733   Gene: ENSRNOG00000011616   Transcript: ENSRNOT00000015733
Sequence length 744
Comment pep:known chromosome:Rnor_5.0:4:9822682:9861708:1 gene:ENSRNOG00000011616 transcript:ENSRNOT00000015733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEIPAETQKYLVERPIFSHPVLQERLHVKDKVTDSIGDKLKQAFTCTPKKVRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSSALKRKTGVNPAIIMGARRKAMRKYAKEVGNANIANATVVKVDAEVD
GENATKPEEEDDEVKFPPIVIKTTFPEELQRFLPQGENIHTVILDFTQVNFMDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREAMA
EQETTVLPPQEDMEPNATPTTPEA
Download sequence
Identical sequences Q9EPH0
NP_110467.1.100692 NP_110467.1.4139 XP_017448406.1.100692 ENSRNOP00000015733 ENSRNOP00000015733 10116.ENSRNOP00000015733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]