SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016194 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016194
Domain Number 1 Region: 342-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000536
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 397-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000968
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000085
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 452-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000016194
Domain Number - Region: 43-126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00329
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 
Domain Number - Region: 880-1066,1095-1176
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00815
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016194   Gene: ENSRNOG00000012045   Transcript: ENSRNOT00000016194
Sequence length 1522
Comment pep:known chromosome:Rnor_5.0:9:30096276:30829729:-1 gene:ENSRNOG00000012045 transcript:ENSRNOT00000016194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCSSKNAFVF
LQYDKNFIQIRRVFPSDFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLK
SENGRTESCGVMYTKCTCPQHLGEWGIDDQSLVLLNNVVLPLNEQTEGCLTQELQTTQVC
NLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSHCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECYNSECTANGQWNQWGHWSGCSKSCDGGWERRVR
TCQGVTVTGQQCEGTSEEIRRCSEQRCPAPYEICPEDVLISMVWKRTPAGDLAFNQCPLN
ATGTTSRRCSLSLHGVASWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTK
TLLDLTQRKNFYAGDLLVSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEK
WEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINF
PMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNY
TVVNSKIIVVTIRPEPKRTDAFLEIELAHLANGTLNPYCVLWDDSKSNESLGTWSTQGCK
TVLTDASHTKCLCDRLSTFAILAQQPREIVMESSGTPSVTLIVGSGLSCLALITLAVVYA
ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVL
TEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCG
VVSTTALSAATASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
HKDIGPCRAATITGTLSRISLNDEEEEKGTNPEGLSYSTLPGNVISKVIIQQPTALHMPM
SMNELSNPCLKKENTELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVSTQP
SMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLDQHLAPQEHMQNLPFEP
RTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQE
LNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKTPSEYPHYTTINVLDTEAKDALELRP
AEWEKCLNLPLDVQEGDFQTEV
Download sequence
Identical sequences D4A831
ENSRNOP00000016194 10116.ENSRNOP00000016194 ENSRNOP00000016194 NP_001100368.1.100692 NP_001100368.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]