SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016317 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016317
Domain Number 1 Region: 417-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.27e-77
Family Eukaryotic proteases 0.0000000944
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.000000424
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.000000402
Further Details:      
 
Domain Number 4 Region: 366-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0000139
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000531
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016317   Gene: ENSRNOG00000011258   Transcript: ENSRNOT00000016317
Sequence length 685
Comment pep:known chromosome:Rnor_5.0:5:169071761:169086477:1 gene:ENSRNOG00000011258 transcript:ENSRNOT00000016317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLIVLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYGNHQDRSWTLTAPPGFRLRLY
FTHFNLELSYRCEYDFVKLTSGTKVLATLCGQESTDTERAPGNDTFYSLGPSLKVTFHSD
YSNEKPFTGFEAFYAAEDVDECRTSLGDSVPCDHYCHNYLGGYYCSCRVGYILHQNKHTC
SALCSGQVFTGRSGFLSSPEYPQPYPKLSSCAYNIRLEEGFSITLDFVESFDVEMHPEAQ
CPYDSLKIQTDKREYGPFCGKTLPPRIETDSNKVTITFTTDESGNHTGWKIHYTSTAQPC
PDPTAPPNGHISPVQATYVLKDSFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPIPE
CSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSS
KGEKSLPVCKPVCGLSTHTSGGRIIGGQPAKPGDFPWQVLLLGETTAAGALIHDDWVLTA
AHAVYGKTEAMSSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKNK
VTINRNIMPICLPRKEAASLMKTDFVGTVAGWGLTQKGFLARNLMFVDIPIVDHQKCATA
YTKQPYPGAKVTVNMLCAGLDAGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCG
GSEQYGVYTKVTNYIPWIENIINNF
Download sequence
Identical sequences A2VCV7
ENSRNOP00000016317 ENSRNOP00000016317 NP_742040.1.100692 NP_742040.1.4139 10116.ENSRNOP00000016317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]