SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016330 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016330
Domain Number 1 Region: 431-688
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.6e-72
Family Eukaryotic proteases 0.0000000839
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-30
Family Spermadhesin, CUB domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 180-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-26
Family Spermadhesin, CUB domain 0.0000586
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0000372
Further Details:      
 
Domain Number 5 Region: 307-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 133-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016330   Gene: ENSRNOG00000011971   Transcript: ENSRNOT00000016330
Sequence length 694
Comment pep:known chromosome:Rnor_5.0:4:224162096:224174113:-1 gene:ENSRNOG00000011971 transcript:ENSRNOT00000016330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSPEMWCFVFFSLLASFSAEPTMYGEILSPNYPQAYPNEVVKTWDIEVPEGFGIHLYF
THLDMELSENCAYDSVQIISGGIEEERLCGQRTSKSPNSPIVEEFQFPYNRLQVVFTSDF
SNEERFTGFAAYYSAVDVNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRTCGVN
CSGDVFTALIGEIASPNYPNPYPENSRCEYQIRLQEGFRLVLTIRREDFDVEPADSEGNC
HDSLTFAAKNQQFGPYCGNGFPGPLTIKTQSNTLDIVFQTDLTGQNKGWKLRYHGDPIPC
PKEISANSIWEPEKAKYVFKDVVKITCVDGFEVVEGNVGSTSFYSTCQSNGQWSNSRLEC
QPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQEEGGEYHCAANGSWVNDQL
GVELPKCIPVCGVPTEPFKVQQRIFGGYSTKIQSFPWQVYFESPRGGGALIDEYWVLTAA
HVVEGNSDPVMYVGSTLLKIERLRNAQRLITERVIIHPSWKQEDDLNTRTNFDNDIALVQ
LKDPVKMGPTVAPICLPETSSDYNPSEGDLGLISGWGRTENRTNVIQLRGAKLPITSLEK
CQQVKVENPKARSNDYVFTDNMICAGEKGVDSCEGDSGGAFALPVPNVKDPKFYVAGLVS
WGKKCGTYGIYTKVKNYVDWILKTMQENSGPKKD
Download sequence
Identical sequences G3V7L3
ENSRNOP00000016330 ENSRNOP00000052911 10116.ENSRNOP00000016330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]