SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016944 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016944
Domain Number 1 Region: 453-531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.88e-19
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 581-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.06e-18
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000288
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 396-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000157
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 6 Region: 522-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000367
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 273-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000996
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 9 Region: 91-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000616
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000059
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016944   Gene: ENSRNOG00000012613   Transcript: ENSRNOT00000016944
Sequence length 661
Comment pep:known_by_projection chromosome:Rnor_5.0:13:61616995:61641162:1 gene:ENSRNOG00000012613 transcript:ENSRNOT00000016944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRHLPFILILIISGELYAEEKQCDFPAVENGRIAQYYYTFKSYYFPMSIDKKLSFFCL
AGYATESGKQEEKIRCTAEGWSPKPRCYKKCLKPVLRNGYVSDGKVLYKIQENMRYGCTS
GYKTTGGKDEEVVQCLSEGWSSQPSCRKEQETCLAPELHHGNYSTIQRTFKVKDRVQYTC
TAGYYTATGKQTEEVECQAHGWSFTPQCNKLMCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPICEGRRNRCPPPPVPLNSKVEPHSTTYRHGEVVHI
ECELNFAIQGSDALVCENGKWTEPPTFTEEKEKVACEQPPSVENGVADPRSEVYYSGDKV
TYRCGGGYRLRGSSTITCNRGRWTLPPECVENIENCKPPPVIANGAVVDDLLASYTTGSS
VEYRCNEYYLLKGSQTSLCEQGTWSSPPVCLEPCTIDVHHMNRNNIQMKWKYEGKILHGD
MIDFVCKQGYVLPLSTTLSEVSVQCNRGDVRYPVCVRRESKGMCASPPVIRNGNIVSLVA
STYENGSSVEYQCFDSHFLQGSRDAYCVDGVWTTPPSCLEPCTLSFVEMDKNYLQLKWNF
DNRPLILHGEYIEFICKGDAYMTETSIPESELRVQCDGGILKYPKCTPRERSLSFQEALR
T
Download sequence
Identical sequences ENSRNOP00000016944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]