SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017053 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017053
Domain Number 1 Region: 159-257
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.13e-35
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 409-491
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.79e-19
Family HSP40/DnaJ peptide-binding domain 0.00086
Further Details:      
 
Domain Number 3 Region: 265-298,365-407
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.57e-17
Family HSP40/DnaJ peptide-binding domain 0.0007
Further Details:      
 
Domain Number 4 Region: 290-362
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.35e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017053   Gene: ENSRNOG00000012106   Transcript: ENSRNOT00000017053
Sequence length 555
Comment pep:known chromosome:Rnor_5.0:8:57859314:57875055:1 gene:ENSRNOG00000012106 transcript:ENSRNOT00000017053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGNQQPQDLDTTAEGSHPLQHPQKCNNPRQTPEHTPAVTEQKAATPRGRGRVGPARTL
PFQSKLSSAQGSRTRGPPASQRISERPNPGDPRKGKGPASGRRDSRQRPTSTTKPESSTP
KTPATEHPNMARGGNQNWSSGESDGQPEEQTSEENGDKMVKETQYYDILGVKPSASPEEI
KKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGSPSF
SSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNIICEKCEGIG
GKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCEDCSGAKV
TREKKIIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMK
MKIQLSEALCGFKKTIKTLDDRVLIISSKSGEVIKHGDLKCVRNEGMPIYKAPLEKGMLI
IQFLVVFPEKQWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFNPNEQSWRQHREAYE
EDDDGPRAGVQCQTA
Download sequence
Identical sequences Q4QR73
NP_001020582.1.100692 NP_001020582.1.4139 ENSRNOP00000017053 ENSRNOP00000017053 10116.ENSRNOP00000017053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]