SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017156 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017156
Domain Number 1 Region: 17-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000276
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000017156
Domain Number - Region: 130-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000335
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017156   Gene: ENSRNOG00000012266   Transcript: ENSRNOT00000017156
Sequence length 241
Comment pep:known chromosome:Rnor_5.0:5:152252915:152294518:-1 gene:ENSRNOG00000012266 transcript:ENSRNOT00000017156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLVPEEEEEKEEAKAEGLEKPDPTK
NSSRKRKKEKKKKKHRDRKSSDCDSPDSESDTGKKARHTAKDSKAPKKKKKKKKHKKKHK
E
Download sequence
Identical sequences D3ZCQ7
ENSRNOP00000017156 10116.ENSRNOP00000017156 NP_001102737.1.100692 NP_001102737.1.4139 XP_006239030.1.100692 ENSRNOP00000017156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]