SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017197 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017197
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.98e-53
Family D-ribulose-5-phosphate 3-epimerase 0.00000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017197   Gene: ENSRNOG00000038085   Transcript: ENSRNOT00000017197
Sequence length 199
Comment pep:known chromosome:Rnor_5.0:9:73595054:73615031:-1 gene:ENSRNOG00000038085 transcript:ENSRNOT00000017197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKAGANMIVSGSAIMRSDDPRAV
INLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences Q3MIF0
ENSRNOP00000017197 NP_001029075.1.100692 NP_001029075.1.4139 XP_021053985.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]