SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017322 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017322
Domain Number 1 Region: 398-541
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-40
Family Third domain of FERM 0.00000927
Further Details:      
 
Domain Number 2 Region: 289-399
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-32
Family Second domain of FERM 0.00000827
Further Details:      
 
Domain Number 3 Region: 215-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.03e-25
Family First domain of FERM 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017322   Gene: ENSRNOG00000012346   Transcript: ENSRNOT00000017322
Sequence length 919
Comment pep:known chromosome:Rnor_5.0:1:22362882:22443605:-1 gene:ENSRNOG00000012346 transcript:ENSRNOT00000017322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVASASEVKKGSDPSGADAHKEKAKEVVENEQTAASELDEGKASQPGPTAESQSSPH
RRKRGKDPSENRGISRFIPPWLKKQKSYSLVVAKDGGDKKEPTQADGEDQILDKEDTLPE
EESRAKGDAEEMAQRKHLEVKVEVREEKSALKSSAEIQPAEQVRKDKEEEVIQDIQEEKL
EGGAAKRETKEVQTSELKAEVASQKAAKKTKTVLAKVTLLDGTEFSCDLEKRAKGQALFD
RVCEHLNLLEKDYFGLIFQEHPEQKNWLDPAKEIKRQLRSLPWLFTFNVKFYPPDPSQLT
EDITRYFLCLQLRQDISSGRLPCSFVTHALLGSYTLQAEHGDYDPEEYDSIDLGDFQFAP
THNKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCA
NGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPGELEQFESTIGFKLPNHRAAKRLW
KVCVEHHTFYRLVSPEQPPKTKFLTLGSKFRYSGRTQAQTREASTLIDRPAPQFERASSK
RVSRSLDGAPIGVVDQSPPGEGSVPGPGVVSYTTVQDGRRDGKSPTKVTPLLAEGKSSHE
TLNVVEEKKRAEVGKGESVITEEMNGKELSPGSGPGETRKVEPMAHKDSTSLSSESSSSS
SESEEDVGEYQPHHRVTEGTIREEQEYEEELEEEPGQGAKVVEREAAMPEAIPDRQAGAS
VLPVETEAQENVVAQKLPGEKGAHRGTAEQDMSEEAEEDQHRVNGEVPHLDIDGLPEIVC
PSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGVLLTAQ
TITSESASTTTTTHITKTVKGGISETRIEKRIVITGDAALDHDQALAQAIREAREQHPDM
SVTRVVVHKETELAEEGED
Download sequence
Identical sequences ENSRNOP00000017322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]