SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017442 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000017442
Domain Number - Region: 20-102
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000707
Family Double-stranded RNA-binding domain (dsRBD) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017442   Gene: ENSRNOG00000012988   Transcript: ENSRNOT00000017442
Sequence length 282
Comment pep:known chromosome:Rnor_5.0:1:60083352:60139891:1 gene:ENSRNOG00000012988 transcript:ENSRNOT00000017442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRTLESLRHIIAQALPHRDPALVFKDLNVVSMLQEFWESKQQQRATFSSEGLVVYESMP
SSGPPFVSYVTLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
VQEAVASTRGTLDDADDPSTSVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALR
ETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKERESPGILSQELRAALGQLEEARKAGQ
ELRFYKEKKEILSLALTQIYCDPDPSSPSDDQLSLTALCGYH
Download sequence
Identical sequences D3ZAG6
10116.ENSRNOP00000017442 ENSRNOP00000017442 NP_001099684.1.100692 NP_001099684.1.4139 ENSRNOP00000017442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]