SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018284 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018284
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.46e-68
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018284   Gene: ENSRNOG00000013636   Transcript: ENSRNOT00000018284
Sequence length 161
Comment pep:known chromosome:Rnor_5.0:9:65122704:65136360:-1 gene:ENSRNOG00000013636 transcript:ENSRNOT00000018284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTG
RGGSSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK
VIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Download sequence
Identical sequences Q812D3
10116.ENSRNOP00000018284 ENSRNOP00000018284 NP_783638.1.100692 NP_783638.1.4139 XP_003507079.1.69978 XP_006245026.1.100692 XP_007611170.1.28591 XP_007611171.1.28591 XP_007645769.1.69978 XP_016821275.1.28591 XP_016833400.1.69978 XP_017451851.1.100692 XP_021055093.1.100879 XP_021510770.1.76796 ENSRNOP00000018284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]