SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018328 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018328
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.34e-125
Family Transglutaminase core 0.0000000000298
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.4e-42
Family Transglutaminase N-terminal domain 0.00000198
Further Details:      
 
Domain Number 3 Region: 472-584
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-32
Family Transglutaminase, two C-terminal domains 0.00000414
Further Details:      
 
Domain Number 4 Region: 585-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-28
Family Transglutaminase, two C-terminal domains 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018328   Gene: ENSRNOG00000012956   Transcript: ENSRNOT00000018328
Sequence length 686
Comment pep:known chromosome:Rnor_5.0:3:160977905:161007258:1 gene:ENSRNOG00000012956 transcript:ENSRNOT00000018328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELNLERCDLEIQANGRDHHTADLCQQKLVLRRGQRFRLTLYFEGRGYEASVDRLTFG
AVTGPDPSEEAGTKARFSLSDDVEEGSWSASVLDQQDNVLSLQLCTPANAPVGQYRLSLE
TSTGYQGSSFMLGHFILLFNAWCPADDVYLDSEAERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDACLMLLDVNPKFLKDRSRDCSRRSSPIYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEYGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDASFVFAEVNADVVDWIRQSDGSVLKSINNSL
VVGQKISTKSVGRDDREDITYTYKYPEGSPEEREVFTRANHLNKLAEKEETGVAMRIRVG
DGMSLGNDFDVFAHIGNDTSESRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLVEPAANSYLLAERDLYLENPEIKIRILGEPKQNR
KLVAEVSLKNPLSDSLYDCVFTVEGAGLTKEQKSVEVSDPVPAGDAVKVRVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNIIIGPA
Download sequence
Identical sequences Q9WVJ6
ENSRNOP00000018328 ENSRNOP00000018328 10116.ENSRNOP00000018328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]