SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018406 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018406
Domain Number 1 Region: 825-1040
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-60
Family DBL homology domain (DH-domain) 0.0000000571
Further Details:      
 
Domain Number 2 Region: 1026-1179
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-46
Family Pleckstrin-homology domain (PH domain) 0.00000146
Further Details:      
 
Domain Number 3 Region: 724-849
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-22
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018406   Gene: ENSRNOG00000013707   Transcript: ENSRNOT00000018407
Sequence length 1247
Comment pep:known chromosome:Rnor_5.0:15:44749846:44875232:1 gene:ENSRNOG00000013707 transcript:ENSRNOT00000018407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTAQDGHGQGATATCSASNPKAPKMVTSSACQNGGCKSSSSDPEAGEARLSPSKLVRLF
SGSRKRMNSNSERPRSVVVVGNSSTWNALASFRKMGSFKRLKSSVLQGIQNREGAEVSKE
ESSGDQGRAAPNGTIAILGKGLGRCASLGPVGDGAGSDCSDPEDTEDAFQRSTHRSRSIR
RAYGLGRISLLDLGRQSVPEPAVCEIQVRDPEPSRAVPLPRRSKSIDSLSVLKSSFKRKS
ASNLTELQGDRQVPSRTLSSFFTDSEKPGGSERRTRRWRSPIRAKDFDRVLKLVSNVKEA
AWKRETPRSAAPSPGSGLGDANPLLAPRSKLHDDYSRRTSSSVEPDARRGGPLSSPCASA
PCTAAPYTAPEPHLDVDTAVFPLESKSAQPLGTDGPHTSSSSPIPTDTEGLSQASSEAHT
GSQHPFDPVQLPTPLRPTTPKPQSPQSPGSTKCPSSLSVLSLSSADSEERSEDAVHRQAG
PMSLQDAVPAAAGDVGGENSESSFPSNPDGATSPEERKEEVRVVTEDDWRQGSALEEEQN
EAPRISRRKWGSGRRTGPRPLSDYGQLASRSLSIPEDAIATDPPGEDRVDRMHPASVTTT
SQDPCTSSGCPRGGRRRRPISVIGGVSFYGNTQAEDVENLLVQPAARPPVPAHQVPPYKA
VSARLRPFTFSQSTPIGLDRVGRRRQMKTSNVSSDGGAESSALVDDNGSEEDFSYEELCQ
ANPRYLQPGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKDWW
WGRNEDKEAWFPASFVRLRVNQEELPEPCSSSQGEEQDEDASKARHKHPESQQQMRTNVI
QEIMNTERVYIKHLKDICEGYIRQCRKHTGMFTVGQLATIFGNIEDIYKFQRKFLKDLEK
QYNKEEPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACVELSNLMKQSKYRHFFEACRLLQ
QMIDIALDGFLLTPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYEAMKNVACLINERK
RKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKITRQGKTQQRVFFLFDHQLVS
CKKDLLRRDMLYYKGRMDMDEVDIVDVEDGRDKDWNLSMRNAFKLVSKATDEVHLFCARK
QEDKARWLQAYADERRRVQEDQQMGMEISENQKKLAMLNAQKAGHGKSKGYNSCPVAPPH
QSLPPLHQRHITVPTSIPQQQVFALAEPKRKPSLFWHTFHKLTPFRK
Download sequence
Identical sequences ENSRNOP00000018406 NP_001178615.1.100692 NP_001178615.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]