SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019245 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019245
Domain Number 1 Region: 3894-4265
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.63e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2902-3270
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-100
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 3 Region: 4402-4733
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-88
Family Hect, E3 ligase catalytic domain 0.000033
Further Details:      
 
Domain Number 4 Region: 368-724
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-86
Family Regulator of chromosome condensation RCC1 0.0075
Further Details:      
 
Domain Number 5 Region: 2673-2855
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2498-2575
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-29
Family CPH domain 0.00066
Further Details:      
 
Domain Number 7 Region: 1807-1873
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.48e-21
Family Mib/herc2 domain 0.00014
Further Details:      
 
Domain Number 8 Region: 1150-1234
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000851
Family Cytochrome b5 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000019245
Domain Number - Region: 2400-2450
Classification Level Classification E-value
Superfamily UBA-like 0.000438
Family UBA domain 0.0083
Further Details:      
 
Domain Number - Region: 3562-3652
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0199
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019245   Gene: ENSRNOG00000013718   Transcript: ENSRNOT00000019245
Sequence length 4779
Comment pep:known chromosome:Rnor_5.0:1:115459547:115658973:1 gene:ENSRNOG00000013718 transcript:ENSRNOT00000019245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVENRYPDDGVDAQSGTKKEDLNDKEKKEEEETPAPVCRAKSILESWVWGRQPDVNELKE
CLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISV
PPTEKKSARPPGRGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRA
LPEASLFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGGVPLQDQHLALAILL
ELAVQRGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLHRFQSILCSKDMP
HTESDMHLLSGPLSPNESFLKYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSS
PTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVMQVACAEKRFLILSRNGRVYT
QAYNSDMLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVP
LEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIP
MLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKL
QDLDVIKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDV
AAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPGLDTKHIVGIACGPAQSF
AWSSCSEWSIGLRVPFVVDICPVTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLN
LLRLQLHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGW
SVLLPTAEERARALSALLPCTGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEI
QDIEAKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLL
RNIASQTVARLKDVARRISSCLDFEQHSCERSASLDLLLRFQRLLISKLYPGENIGPISD
TSSPELMGVGSLLKKYTALVCTHIGDILPVAASIASSSWQHFAEVACVMEGDFTGVLLPE
LVVSIVLLLSKNASLMQEAGAIPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFF
TGQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGED
PVVALEAALQFEDTQESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLH
ASYLAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPISKSR
LCSHRWALGDHSQAFLQAIADNNIQDYNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEV
GRLLLCCLLKHEDLGHVALSLVHVGTLGIEQVKHRALPKAVVDVCRVVYQAKCSLIKTHQ
EQGRSYKEVCAPVIERLRFLFNELRPAVCSDLSIMSKFKLLGSLPRWRRIAQKIIRERRR
KRVPKKPESTDGEEKIGNEESDLEEACVLPHSPINVDKRPISMKSPKDKWQPLLNTVTGV
HKYKWLKQNVQGLYPQSALLNTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTIL
KLAAKSFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLRDVDLIPPFNRMLLEVTFGKLY
AWAVQNIRSVLMDASAKFKELGIQPVPLQTITNENPAGPSLGTIPQARFLLVMLSMLTLQ
HGANNLDLLLNSGTLALTQTALKLIGPTCDSVEDDMNASARGASATVLEETRKETAPVQL
PVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSY
RMGKEGKYDLKLVELPVSSQPSAEDSDTEDDSEAEQGERNIHPTAMMLTSVINLLQTLCL
SVGVHADIMQSEATKTLCGLLRMLVESGTTDKPSPPDRLVAREQHRSWCTLGFVRSIALT
PQACGALSSPRWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCL
VEKLFGFLGSLLTTCSSDVPLLRESTLRKRRARPQASLTATHSSTLAEEVVGLLRTLHSL
TQWNGLINKYINSQLCSVTQSYAGKTSERTLLEDYFPDSENLEVGGLMAVLAVIGGIDGR
LRLGGQVMHDEFGEGTVTRITPKGKITVQFCDMRMCRVCPLNQLKPLPAVAFSVNNLPFT
EPMLSVWAELVNLAGSKLEKHKTKKSAKQAFAGQVDLDLLRSQQLKLYILKAGRALLSHQ
DKLRQILSQPAVQETGTLHTDDGAAASPDLGDMSPEGPQPPMILLQQLLSSATQPSPVKA
IFDKQELEAAALALCQCLAVESTHPSSPGCEDCSSSEATTPVSVQHIHLARAKKHRQSPA
PALPIVVQLMEMGFPRKNIEFALKSLTGTSGNASGLPGVEALVGWLLDHSDVQVTEFSDA
ETVSDEYSDEEVVEDVDDTPYPVAAGAVVTESQTYKKRADFLSNDDYAVYVRENVQVGMM
VRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSS
SHIKIGDKVRVKASVTTPKYKWGSVTHQSVGLVKAFSANGKDIIVDFPQQSHWTGLLSEM
ELVPSIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQS
AVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQG
KHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININQTDTTVP
LLSDCAEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDD
KGSTGSLIRKKTPGLESTATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQ
VAGGSKSLFAVTVEGKVYSCGEATNGRLGLGMSSGTVPIPRQITALSSYVVKKVAVHSGG
RHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTS
SGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFS
WGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFR
LGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTV
NRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPS
DADSSSSSNKISGVSNCKPNRPSLAKILLSLEGNLAKQQALSHILTALQIMYARDAVVGA
LMPAGMLAPVECPSFSSSAPASDVSAMASPMNVEESMLAADLEDRLSPNLWQEKREIVSS
EDAVTPSAVTPSAPSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKTSGPEPQSLD
EFTSLLIPDDTRVVVDLLKLSVCSRAGDRGREVLSAVLSGMGIAYPQVADMLLELCVTEL
EDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPL
TVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGP
KDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWAL
QRLRRLLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIV
RGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPR
LFLDEVAKKIRELMADSESMDVLHESHSIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIY
GWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGG
RLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGN
RSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPK
LVEALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLT
GLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIA
TGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLA
WSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDE
TGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLA
GPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQN
GLTPLLIVTPNGRDESGANRDCYLLNPATRAPVHCSMFRFLGVLLGIAIRTGSPLSLNLA
EPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQL
SSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVC
GSPDIPLHLLKSVATYKGIEPSASLVQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIAD
FRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDD
YARIALTGEPAADDSSEDSDNEDADSFASDSTQDYLTGH
Download sequence
Identical sequences D4ACN3
NP_001100990.1.100692 NP_001100990.1.4139 ENSRNOP00000019245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]