SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019404 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019404
Domain Number 1 Region: 10-132
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-37
Family Phosphotyrosine-binding domain (PTB) 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019404   Gene: ENSRNOG00000014328   Transcript: ENSRNOT00000019404
Sequence length 493
Comment pep:known chromosome:Rnor_5.0:9:14222004:14228827:-1 gene:ENSRNOG00000014328 transcript:ENSRNOT00000019404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCLDRDSVPHNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHQQEAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVTEEPVIIT
RNSHPQELDLPRGSSQPTGYTVSSFSNGFPGCPGEGPRFSSAPRRPSTSSLRHPSPGEES
TQTLIASDEQSHTYVNTPTGEEDRRSRHCLQPLPEGRVPFPPQTQVSDQRDPQVFLQPGQ
VKFVLGPTPARRQVMKCQSLCPSMQDPPLHNNNNEGPSECPAQPKCTYENVSGGLQQGAG
WRLSPEERGWSGLAHRRAALLHYENLPPLPPVWESQVQQLGGEAGDDGDSKDGLTPSSNG
FPDGEEDETPLQKPTSTRASARSHSSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQ
VELKGWGTAHPKGPQNPSVSGAPGPTPHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGT
VRKTRHNSTDLPL
Download sequence
Identical sequences G3V7U7
10116.ENSRNOP00000019404 ENSRNOP00000019404 XP_006244498.1.100692 XP_006244499.1.100692 ENSRNOP00000019404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]