SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019442 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019442
Domain Number 1 Region: 124-310
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000192
Further Details:      
 
Domain Number 2 Region: 477-586
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-28
Family SH2 domain 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019442   Gene: ENSRNOG00000014366   Transcript: ENSRNOT00000019442
Sequence length 594
Comment pep:known chromosome:Rnor_5.0:17:15743125:15862911:1 gene:ENSRNOG00000014366 transcript:ENSRNOT00000019442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGSGGKVSAEPAASPYLVSGEALRKAPDDGPGS
LGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGGSATPGSRAPAAS
MSATRKSRASDEPLPRPPRGAPHASDQVLGSGVTYVVKYLGCIEVLRSMRSLDFSTRTQV
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPSKIPALQDRMQSLDEPWTEEEGDGPDHPYYNSVPNKMPPPGGFLDARL
KARPHAPDAAQFSGKEQTYYQGRHLGDAFGEDWQRAPTRQGSLDIYSTPEGKAHMVPVGE
TPTYVNTQPVPPQVWPAATSSTESSPRKDLFDMKPFEDALRNQPLGPVLSKAASVECISP
VTPRAPDAKMLEELNAEPWYQGEMSRKEAEALLQEDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTVRTKDRVFDSISHLITYHLESSLPIVSAGSELCLRQPVERKP
Download sequence
Identical sequences G3V7V0
ENSRNOP00000019442 NP_001099213.1.100692 NP_001099213.1.4139 10116.ENSRNOP00000019442 ENSRNOP00000019442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]