SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019596 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019596
Domain Number 1 Region: 159-451
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-83
Family Eukaryotic proteases 0.000000142
Further Details:      
 
Domain Number 2 Region: 41-99
Classification Level Classification E-value
Superfamily GLA-domain 6.22e-22
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 98-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000382
Family EGF-type module 0.002
Further Details:      
 
Domain Number 4 Region: 137-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000728
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019596   Gene: ENSRNOG00000014376   Transcript: ENSRNOT00000019596
Sequence length 461
Comment pep:known chromosome:Rnor_5.0:18:24633207:24643549:-1 gene:ENSRNOG00000014376 transcript:ENSRNOT00000019596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQFRIFLLFASTWGISGVSAHPDPVFSSSEGAHQVLRVRRANSFLEEVRAGSLERECME
EICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSTPPLDHQCDSPCCGHGTCIDGLGGFSCS
CDKGWEGRFCQQEMGFQDCRVKNGGCYHYCLEETRGRRCACAPGYELADDHMHCRPTVNF
PCGKLWKRTDKKRKNFKRDIDPEDEELELGPRIVNGTLTKQGDSPWQAILLDSKKKLACG
GVLIHTSWVLTAAHCLESSKKLTVRLGEYDLRRRDPWELDLDIKEVLVHPNYTRSNSDND
IALLRLSQPATLSKTIVPICLPNSGLAQELSQAGQETVVTGWGYQSDKVKDGRRNRTFIL
TFIRIPLAARNDCMQVMNNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLV
SWGEGCGHLNNYGVYTKVGSYLKWIHSYIGERDVSLKSPKL
Download sequence
Identical sequences Q68FY8
ENSRNOP00000019596 ENSRNOP00000019596 XP_006254589.1.100692 XP_008770240.2.100692 10116.ENSRNOP00000019596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]