SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020111 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020111
Domain Number 1 Region: 179-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000419
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 2 Region: 123-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000068
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020111   Gene: ENSRNOG00000014927   Transcript: ENSRNOT00000020111
Sequence length 271
Comment pep:known chromosome:Rnor_5.0:2:48035517:48044197:1 gene:ENSRNOG00000014927 transcript:ENSRNOT00000020111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWARVTTSNSKRPLSATSWEDMKKGSAEGANQNPSNHKRCQVSGLSLRNDAPQAKHKK
NKKKKEYLNEDVNGFMEYLKQSSQVLHNGQLIAADSREVREEIAVALKKDSRREGRRLKR
QAAKKNAMVCFHCRQPGHGIADCPAVLESQDMGTGICYRCGSTEHEMTKCRANVDPALGE
FPFAKCFVCGEMGHLSRSCPDNTKGVYADGGGCKLCGSVEHFKKDCPENQNSDRIITVGR
WAKGMSADHEDVLDVPKPQKPKTKVPKVVNF
Download sequence
Identical sequences Q5XII6
ENSRNOP00000020111 10116.ENSRNOP00000020111 NP_001013174.1.100692 NP_001013174.1.4139 XP_006231903.1.100692 XP_017446309.1.100692 ENSRNOP00000020217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]