SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020148 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020148
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000228
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020148   Gene: ENSRNOG00000014957   Transcript: ENSRNOT00000020148
Sequence length 295
Comment pep:known chromosome:Rnor_5.0:18:17093464:17148510:-1 gene:ENSRNOG00000014957 transcript:ENSRNOT00000020148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETPPPMQAGSKPHLEKLTLGVTRILESSPGVTEVSIIEKLPAERHMISSWEQKNNCVM
PEDVRNFYLMTNGFHMTWSVKLDDHIIPLGSMVINGISLTQLIQSSVYSLPNAPTLADLE
DDSQEGNEDHQLEKPHFDCRSAIFELDSCGGNGKVCLVYKNGKPGLAHDTEIWFLDRALY
WHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTSLLTEEPDT
FVNKLDPSKVFKSKNKILIPKKKGPVQPVSGQKGPGPLAPPTSKPSAGCGNPVRK
Download sequence
Identical sequences F1LR55
ENSRNOP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]