SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020182 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020182
Domain Number 1 Region: 49-159
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 176-304
Classification Level Classification E-value
Superfamily TIMP-like 9.73e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020182   Gene: ENSRNOG00000014940   Transcript: ENSRNOT00000020182
Sequence length 314
Comment pep:known chromosome:Rnor_5.0:1:268894580:268899042:-1 gene:ENSRNOG00000014940 transcript:ENSRNOT00000020182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGGARTAALALLLGALHGAPARGQEYDYYGWQTEPLHGRSYSKPPQCLDIPADLPLC
HTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYP
CRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQ
CEIEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKL
VLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPC
SLYYPFFYGAAEPH
Download sequence
Identical sequences D3ZTV6
NP_001101061.1.100692 NP_001101061.1.4139 10116.ENSRNOP00000020182 ENSRNOP00000020182 ENSRNOP00000020182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]