SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021568 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021568
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-117
Family Transglutaminase core 0.0000000000179
Further Details:      
 
Domain Number 2 Region: 8-191
Classification Level Classification E-value
Superfamily E set domains 2.62e-55
Family Transglutaminase N-terminal domain 0.0000000187
Further Details:      
 
Domain Number 3 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-30
Family Transglutaminase, two C-terminal domains 0.00000515
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.36e-28
Family Transglutaminase, two C-terminal domains 0.00000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021568   Gene: ENSRNOG00000015957   Transcript: ENSRNOT00000021568
Sequence length 732
Comment pep:known chromosome:Rnor_5.0:17:30406396:30581429:1 gene:ENSRNOG00000015957 transcript:ENSRNOT00000021568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTPATTFGGRRAIPPNNSNAAEVDLPTEDLQGLVPRGVSLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVTELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTQRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFHGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGS
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVENVDATHIGKLIVTKEIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVDMNFDVENAVLGKDFRVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKTESFEVTLDPLSLEKKEVLIRAGEYMSYLL
EQGLLHFFVTARINETRVVLAKQKSIVLTIPKVTIKVRGTAMVGSDMVVTVEFTNPLKET
LKNVWLHLEGPGVMRPKRKMFREIRPNATVQWEEVCQPWVSGHRKLIASMTSDSLRHVYG
ELDLQIRRRPTV
Download sequence
Identical sequences G3V811
10116.ENSRNOP00000021568 NP_067730.2.100692 NP_067730.2.4139 ENSRNOP00000056950 ENSRNOP00000021568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]