SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021739 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021739
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 173-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-18
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021739   Gene: ENSRNOG00000016245   Transcript: ENSRNOT00000021739
Sequence length 525
Comment pep:known chromosome:Rnor_5.0:19:33456905:33493500:1 gene:ENSRNOG00000016245 transcript:ENSRNOT00000021739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAFIYVCIILKMLLITVLVVEGIAVAQKTQDGQNIGIKHVPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGMKSPALIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSAIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTSS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGVTSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLREKEISADLADLSEELD
NYQKLRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQTHDCPEQALEDRVMEEIPCEIYVRGRDDSAQASISIDF
Download sequence
Identical sequences F1MA16
10116.ENSRNOP00000021739 ENSRNOP00000061475 ENSRNOP00000021739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]