SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021949 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021949
Domain Number 1 Region: 285-531
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-88
Family Eukaryotic proteases 0.000027
Further Details:      
 
Domain Number 2 Region: 196-292
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-19
Family Hepsin, N-terminal domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000021949
Domain Number - Region: 175-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021949   Gene: ENSRNOG00000016397   Transcript: ENSRNOT00000021949
Sequence length 539
Comment pep:known chromosome:Rnor_5.0:8:48247921:48277211:1 gene:ENSRNOG00000016397 transcript:ENSRNOT00000021949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGSHRNASPARPSPQASPARASPQASPARTPPPQASPARASPPQASPARASPARASPV
RASPARAPPSRSSSGRSSSARSASTTSSPTRVYLVRAIPVGTVIRASPARSAPATRATRE
SPGLSFPKFSWQETQRQLPLIGCVLLLISLVISLILLFYFWRGHTGIKYKEPLESCPKHA
VRCDGVVDCKMKSDELGCVRFDWDKSLLKVYSGSSGEWLPVCSSSWNDTDSERTCQQLGF
DSAYRTTEVAHRDVTSSFLLSEYNSTIQESLTRSECPSRRYVSLQCAHCGLRAMTGRIVG
GALTSESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKILEGWKVYAGTSNL
HQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPLTLSAHIHPACLPLHGQTFGLNETC
WITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQ
GDSGGPLVCEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYRKMESEVRFRKS
Download sequence
Identical sequences B2RYJ5
10116.ENSRNOP00000021949 ENSRNOP00000021949 NP_001121000.1.100692 NP_001121000.1.4139 ENSRNOP00000021949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]