SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022290 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022290
Domain Number 1 Region: 1005-1186
Classification Level Classification E-value
Superfamily Fibronectin type III 7.3e-19
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 908-987
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000973
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 697-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 5 Region: 792-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000352
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 311-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000183
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 7 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 8 Region: 543-663
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000439
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 9 Region: 431-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000183
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 659-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 830-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000858
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 12 Region: 351-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1310-1345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 275-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 15 Region: 870-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 472-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000037
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000022290
Domain Number - Region: 507-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022290   Gene: ENSRNOG00000023548   Transcript: ENSRNOT00000022290
Sequence length 1404
Comment pep:known chromosome:Rnor_5.0:9:100037560:100093411:1 gene:ENSRNOG00000023548 transcript:ENSRNOT00000022290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGAAWALLLAAALGLGARGVRAAVALADFYPFGTKRGDAVTPKQDDGGSGLQPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDAAMLNRATEDIRRYFPELPDFSATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGR
FSFTIFNYESILWTTGTHASSGGDADGLGGIAAQAGFNAGDGHRYFNIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLVLRPCLNGGKCIDDCVTGNPSYTCSCL
AGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAGFQGPTCESAQSPCDNKVCQN
GGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCLNGGSCVDLVGNYSCICVEPFEGP
QCETGSYVVPSPCLSNPCLNGGTCVDADQGYVCECPEGFMGLDCRERILNDCDCRNGGRC
LGANTTICQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHS
LPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKTARPHLCSSGPCRNGGTCKETG
DEYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPS
PCFRSPCMNGGICEDLGTDFSCHCQPGYTGHRCQAEVDCGQPEEVKHATMRLNGTRMGSV
ALYTCDPGFSLSVLSHMRVCQPQGVWSQPPQCIEVDECQSQPCLHKGSCQDLIAGYQCLC
SPGYEGVHCELETDECQAQPCRNGGSCRDLPGAFICQCPEGFVGTHCETEVDACASSPCQ
HGGRCEDGGGAYLCVCPEGFFGYNCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTG
KDCTKELLPPTALRVERVEESGVSISWSPPEGTTARQVLDGYAVTYASSDGSSRRTDFVD
RSRSSHQLRALAAGRAYNISVFSVKRNTNNKNDISRPAALLTRTRPRPIEDFEVTNISAN
AISVQWALHRIQHATVSRVRVSVLYPEDTVVQSTEVDRSVDRLTFGDLLPGRRYSVRLTT
LSGPGGAEYPTESLASAPLNVWTRPLPPANLTASRVTATSAHMVWDPPTPGISLEAYVIN
VTTSQNTKSRYIPNGKLVSYTVRDLMPGRRYQLSVTAVQSTEQGQLHSEPAHLYIITSPR
DGTDRRWHQGGHHSRMLRNRPAPLRLPELRLLNDHGAPETPTQPPRFSELVDGRARVSAR
FGGLPSRAVTVRSQPTTPVPLKNTEAPEQARLALQLPKNNSKDTESTPGSCSEDTCQNGG
TCVPGANAHSCDCRPGFKGRHCELACEKVPRPCTRLFSETKSFPVWEGDVCHHVYKKVYK
VHQDVCFKERCQSTSLKKLKQESN
Download sequence
Identical sequences ENSRNOP00000022290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]