SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022390 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022390
Domain Number 1 Region: 973-1136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-33
Family MAM domain 0.0017
Further Details:      
 
Domain Number 2 Region: 655-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-33
Family MAM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 63-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-32
Family MAM domain 0.0068
Further Details:      
 
Domain Number 4 Region: 815-970
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-29
Family MAM domain 0.0013
Further Details:      
 
Domain Number 5 Region: 488-644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-18
Family MAM domain 0.009
Further Details:      
 
Domain Number 6 Region: 271-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-18
Family MAM domain 0.013
Further Details:      
 
Domain Number 7 Region: 225-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 451-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000022390
Domain Number - Region: 31-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0157
Family LDL receptor-like module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022390   Gene: ENSRNOG00000016584   Transcript: ENSRNOT00000022390
Sequence length 1215
Comment pep:known chromosome:Rnor_5.0:3:2767936:2776522:-1 gene:ENSRNOG00000016584 transcript:ENSRNOT00000022390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLPSCLLSIWVLFMAAQSLGKTWVPDHCRSPTEATCNFVCDCGDCSDEAQCGFHGASTT
PNTPFTCNFEQDPCGWQDISTSGYRWLRDRAGAGLDSSGPHSDHTRGTDLGWYMAVGTHS
GKEPSTATLRSPVMREAAPTCELRLWYHTDSRDVAELRLDLTHGMETLTLWQSSGPWGPG
WQELAVNTGRIQGDFKVTFSATRNATHRGAVALDDMEFWDCGLPIPQARCPLGHHHCQNK
ACVEPHQLCDGEDNCGDSSDEDPLICSHHMATDFETGLGPWTQLEGWTRNFSAGSMVSPA
WPHRDHSRNSAYGFFLVSVAKPGTTAVLYSPEFQGSVSYNCSFTFYYYLHGSEANQFQLF
VQAQGLNTTQPPVLLRSRHGELGTAWVRDRVNIQSAHPFRILLAGETGPGGFVGLDDLIM
SNHCILVPGMSTLQSSLSGPVPLALYPQTSIKRTCEPGHLSCDELCVPPEQLCDFQQHCA
EGEDEEKCGTTDFESASAGGWEDISIGKLQWQRAEAQESGKPARDTNRNAPGHFLSLRKA
WGQLRSEARALTPALGPSGPHCELHMTYYFHSHPQGFLALAVVENGFRELLWQAPSSSSG
GWTLQKILLGARRRPFQLEFVSLVDLDGPGQQGAGVDNVTLRDCNPMVTTESDQEVSCNF
ERDSCSWHTGHLTDAHWHRVKSHGSQYDHTTGQGFFMFLDPMDPPARGQGALLLTRPQVP
VVPKECLSFWYHLHGPQIGTLCLAMRREGEEDTLLWSRSGTHGNRWHQAWVTLHHQLQPS
TKYQLLFEGLRDGYHGTMGLDDMAVRPGPCWAAKRCSFEDSDCGFSPGGWGLWTRQNNAS
GLGPWGPWIDHTTGTAQGHYMVVDTSPNLLPKGHVASLTSEEHPPLSRPACLTFWYHLSF
HNPGTLRVFVEESTRRQELSISGHGGFAWRLGSVNVQAEQAWKVVFEAMASGVEHSYMAL
DDISLQDGPCAQPGSCDFESGLCGWSHLPWPGLGGYSWDWSSGATPSRYPRPSVDHTVGT
EAGHFAFFETSVLGPGGQAAWLRSEPLPATAVSCLHFWYYMGFPAHFYKGELRVLLSSTQ
GQLAVWHRGGHLRDQWLQVQIEVSSSEEFQIVFEATLGGQPALGPIALDDVEYLAGQHCK
QPTPSQGGVAAPVSVPVAVGGALLLFLLLLGLGGWHWLQKQHLPCQSTDAAASGFDNILF
NADQVTLPESITSNP
Download sequence
Identical sequences F1LMU6
10116.ENSRNOP00000022390 ENSRNOP00000062120 ENSRNOP00000022390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]