SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022532 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022532
Domain Number 1 Region: 35-339,432-477
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-26
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022532   Gene: ENSRNOG00000016704   Transcript: ENSRNOT00000022532
Sequence length 504
Comment pep:known chromosome:Rnor_5.0:4:182758202:182769261:-1 gene:ENSRNOG00000016704 transcript:ENSRNOT00000022532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRFAATLVGSLFGLGLLLCGLGRLASAEPRAPPEKIAIVGAGIGGTSSAYYLRKKFGKD
VKIDVFEREEIGGRLATLKVQGHDYEAGGSVIHPLNLHMKRFVKELGLSSVPASGGLVGV
YNGKSLVFEESSWFIINVIKLVWRYGFQSLRMHMWVEDLLDKFMRIYRYQSHDYAFSSVE
KLMYAIGGDDYVRLLNQTLRENLKKAGFSETFLNEMIAPVMKVNFGQSTDLNAFVGAVSM
TAADSNLWAVEGGNKVVCSGLLQASNSNLISGSVMSIEKTRTKQTGTPPKMYEVVYKTGS
EIHSDFYDIVLVAAPLNRKMSNITFRNFDPPIEEFNDPYQQLVTTLIKGELNSTLFSSRH
KDQFGLSAILVTDDSDMFINSLSIVASVSHKEGPPPAVDGMHVWKTFSKDILTKEQISKL
FLSYDYAVRKPWLSYPYYNPPQKCPSIILHDRLYYLNGIEFAASCMEMSAIAGYNAALLA
YHRWNGNEDMIDQDDLYEKLKTEL
Download sequence
Identical sequences Q99ML5
NP_659553.1.100692 NP_659553.1.4139 ENSRNOP00000022532 10116.ENSRNOP00000022532 ENSRNOP00000022532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]