SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022693 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022693
Domain Number 1 Region: 58-301
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-94
Family Caspase catalytic domain 0.000000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022693   Gene: ENSRNOG00000016836   Transcript: ENSRNOT00000022693
Sequence length 303
Comment pep:known chromosome:Rnor_5.0:1:284591629:284623731:1 gene:ENSRNOG00000016836 transcript:ENSRNOT00000022693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDDQDCAAELEMADSSTEDGVDAKPDRSTIISSLLWKKKKNASMCPVSTTRDRVPTYLY
RMDFEKMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKCFRSLGFEVTVYNDCSCAKMQ
DLLRRASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGXXSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FGR
Download sequence
Identical sequences ENSRNOP00000022693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]