SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023252 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023252
Domain Number 1 Region: 14-357
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.19e-109
Family Phosphofructokinase 0.000000269
Further Details:      
 
Domain Number 2 Region: 349-770
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.32e-105
Family Phosphofructokinase 0.00000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023252   Gene: ENSRNOG00000017163   Transcript: ENSRNOT00000023252
Sequence length 786
Comment pep:known chromosome:Rnor_5.0:17:70227568:70290412:-1 gene:ENSRNOG00000017163 transcript:ENSRNOT00000023252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQDSSTSSTSFPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFI
YEGYQGMVDGGSNIVEAKWECVSSILQVGGTIIGSARCQAFRSREGRLKAACNLVRLGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELAKNGEIDSDTVKKHAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEEMCLKLSENRARKKRLNIIIVSEGAIDTQNKPITSEKIKELVVTNLGFDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLRGNQAVRLPLMEC
VQMTQDVQKAMDERRFDEAVKLRGRSFEGNLNTYKRLAIKEPDDKIPKSNCNVAIINVGA
PAAGMNAAVRSAVRVGIAEGHKMFAIYDGFDGLANGQXXEIGWGDVGGWTGQGGSILGTK
RTLPGKYLEKIAEQMHSKNINALLIIGGFEAYLGLLELAAARNKHEAFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEQFDIRDLQSNVMHLTEKMKTARGLVLRNENCSVNYTTDFIYQLYSEEGKGVF
DCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSHGTGKKFVSDDSICVLGI
QKRDLLFKPVAELRKATDFEHRIPKQQWWLKLRPIMKILAKYEASYDMSDVGKLEPVHNH
GELSAI
Download sequence
Identical sequences ENSRNOP00000023252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]