SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023414 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023414
Domain Number 1 Region: 324-591
Classification Level Classification E-value
Superfamily Kelch motif 6.67e-41
Family Kelch motif 0.0092
Further Details:      
 
Domain Number 2 Region: 679-848
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-26
Family C-type lectin domain 0.00094
Further Details:      
 
Domain Number 3 Region: 62-184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 985-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023414
Domain Number - Region: 32-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023414   Gene: ENSRNOG00000017406   Transcript: ENSRNOT00000023414
Sequence length 1236
Comment pep:novel chromosome:Rnor_5.0:1:285926442:286113279:1 gene:ENSRNOG00000017406 transcript:ENSRNOT00000023414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGASSWLLLDGNSWLLCYGFLYLALYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGD
QCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMY
VYDGDSIYAPLVAVLSGLIVPEVRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSI
NSCPNNCSGHGKCTTSVSVASQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKL
CVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYS
SFQMVLNYNLESSIWNVGAVSRGPLQRYGHSLALYQENIFMYGGRMETSDGNVTDELWVF
NVRSQSWSTKTPTILGHGQQYAVEGHSAHIMELDSGDVVMIVIFGYSAIYGYTSSIQEYH
ISSNTWLVPETKGAIVQGGYGHTSVYDEMTKSVYVHGGYKALPGNKYGLVDDLYKYEVNS
RTWTILKESGFARYLHSAVLISGAVLVFGGNTHNDTSLSNGAKCFSADFLAYDIACDEWK
TLPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPSCKAFRDEELCRNAG
PGIKCVWNKNHCESWESGNANLLRAKCPPRTAASDDRCYRYADCASCTANTNGCQWCDDK
KCISASSNCSTSVRNYTKCHIRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCG
EGWNHVGDSCLRINSSRESYDSAKLYCYNLSGNLASLTTSKEVGFVLDEIQKNTQQRVSP
WVGLRKINISYWGWEDMSPFTNTSLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSMADG
LVCEKPVVSPNQNARPCKKPCSLRTSCANCTSNGMECMWCSSTKRCVDSNAYIISFPYGQ
CLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGYCIEGSSRGPMKLAGVHNS
EVALDTSLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGRQCQDCMPGYYG
DPTNGGQCTACTCGGHANVCHLHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTCYYS
LLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTGGTI
SGEETPIVSKMNIKEYRDSFSYEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNTIMD
LVQFFIHFLVCFLSLLLVAAVVWKIKQTCWASRRRE
Download sequence
Identical sequences ENSRNOP00000023414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]