SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023678 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023678
Domain Number 1 Region: 1911-2211
Classification Level Classification E-value
Superfamily BEACH domain 1.24e-125
Family BEACH domain 0.00000000782
Further Details:      
 
Domain Number 2 Region: 2331-2584
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.37e-29
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 1814-1910
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-26
Family PreBEACH PH-like domain 0.0037
Further Details:      
 
Domain Number 4 Region: 11-537,794-817,858-1052,1081-1099
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000487
Family Armadillo repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023678   Gene: ENSRNOG00000021525   Transcript: ENSRNOT00000023678
Sequence length 2621
Comment pep:known_by_projection chromosome:Rnor_5.0:9:66766280:66923953:1 gene:ENSRNOG00000021525 transcript:ENSRNOT00000023678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARERLFELWMLYCTKKDPDYLRLWLDNFVLSYEQFLDVDFEKLPTRVDDMPPGISLLP
DNILQVLRIQLLHCVQKTADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVI
TMTTLYIQQLKSKKKEKEMADQTSIEEFVIHALAFCESLYDPYRNWRHRISGRILSSVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQKNALQAISPATM
EVLMRVLSDCDSWEEGDPEEVGRKRELTLKCLTQVVHILLTSSSDQRQVETSTILENYFK
LLNSDHSALPKQGRSRRWESQFIALQIKMLNTITAMLDCADRPVLQAVFLNSNCFEHLIR
LLQNCKVFQGQLDCLAVSTIQALTAVMKNSPAAKEVFKERIGYMHMFEVLKSLGQPPQEL
LKELMNMAVEGDHTSVGILGISNVHPLLVLIQWLPELESHDLQIFISDWLKKICCINKQS
RTTCVNANMGIKIIETLESHSSLHRTCAENLIAIHGSLGSQSVSSEELRRLLRLLRVDES
ECIHPYTIPVTRAILIMARKLSFESALQYFNLSHSMAGISVPPIQKWPGSAFSFTAWFCL
DQDPLSLGNANKGGKRKQLYSCVLSKNVAFNKQDFSVALAVLALTLQTRLTLNCLLLPPE
CWKGLCHDIPVINFSMLYGFKNFIRILKFFSFALVQCFSICKYMYTVCFNSLSNLKYLDF
KVCSGNIESKRPCISDVCVCPNCLSPWKCQDCDMAGLPSNLLLHYTGKACKNSICLDLSS
NCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISHVSEGQACEAVSENTVPELITP
IEQEGMGVASTKASESRLEKNLIATFILIVKHFIQRHPINQDNLIQSHGVATLGALLQKV
PGTLMDVNVLMAIQLLIEQVSLEKNTLLLQQMYQCLLFDFRIWNRGDFPFRIGHIQYLST
IIKDSRRVFRKKYGVQFLLDTLRIYYGHSSICNELSPDDIRTIRTSLYGLIKYFLCKGGS
HEEIQSIIGYIAATNEEEQLFGILDILFSLLRTSPTRGQLFLLMFEPGNADILYALLLNQ
KYSDKLREIIFKVMEQMLKCTNVYERSKQRIRLREVGYSGIGLLLNEVPVNTSLIKNFVN
QIINTDPVINFKDLLSIVYICHRAHVNVRVTLCRKILQILQSQPDAAYQISQQVGWQDTF
VRLFLKANFENINSLNKHGKTISVKENKNMSTEDVKRTFEKLDDEKMTLADISSDHWSLE
DSQSLNSNTPLFQEDSSEGELSFRSENQEEFWHSNTSHLSLDLSGIDASELSDSGSQMPD
SSPSTPSPVESTKSFSVQSDKDRTITNEMGFSDDFSFLESQERCEEELFQLLTNILNYVL
CKGLEKSDEDTWIERGQVFSALTKPGISSELIRPSDEVKLTLLQKMLEWAVTENRDAKSS
PVTAENAFRLMLIIQDFLQSEGLVNSNMWTEKLLEDTTQLLDCLSVWYSENPVWVKLSQI
QIQLLLEFIGRGSLQVCAMASAKLNALLQTKVIANQDEACYILGKLEHILSRSIKEQTEI
YSFLIPLLRTLVSKIYELLFMNLHLPSLPFTNGSTSVFEDFQEYCNSNEWQVYIEKYIVP
YMKQYEAHTFYDGHENMALYWKNCYEALMVNMHKRDREGGESKLKFQEYFVEPFNRKARQ
ENLRYNNMIKQLTSQQLAASRHWKAIRLYLTCERGPWAEKKQNRIHWKLANVENYSRMRL
KLVPNYNFKTHEEASALRDNLGVQHLQPSSDALLLEVVKQVRLSDVEEDRLELLEEDTAA
SALTDEKEEQDQKEKLVLTEDCELITVIDIIPGRLEVTTQHIYFHDNSIEKEDGQGFDFK
WPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKVYSRLLSLHSPNSYGTRS
PQELFKASGLTQKWVNREITNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYTSEELDLN
NPTVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVMHYLIRVE
PFTTLHIQLQSGRFDCADRQFHSIPATWQALMENTYDVKELIPEFFYFPEFLENQNEFNL
GQLQVSKELVNDVILPRWAKSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAV
EALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEPHPPRLSAEEAIQK
QTKTEISTLNLFQHLPELKSFFIEGISDGIPLLKAIIPRNQSRSFMSQGSPELLITVSMN
YVIGTHGWLPYDRNISNYFTFIKDQTVTNPKAQRALSGPFAPGLEITSKLFAVSHDAKLL
FSAGHWDNSIQVMSLTKGKLVSHNIRHIDIVTCLATDYCGIHLISGSRDTTCMIWQITQQ
GGTPVGLAPKPFQILYGHTDEILSVGISTELDMAVSGSRDGSVIIHTIQKGQYLRTLRPP
CESSLFLTIPSLAISWEGHIVVYSSLEEKSTLKDKNLLHVFSINGKYLGSQVLSEQISDM
CIVGEHIITGSLQGLLSVRELHSLKLSIAPLAMRLPIHCVSITKEHSHILVGLEDGKLIV
VGVGKPAEMRSGQLSRKLWGSSKRLSQISAGETEYNTQDFK
Download sequence
Identical sequences ENSRNOP00000023678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]